Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026548-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026548-M02, RRID:AB_1577203
- Product name
- ITGB1BP2 monoclonal antibody (M02), clone 3G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITGB1BP2.
- Antigen sequence
KASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSS
VFLMPSRVEISLVKADPGSWAQLEHPDALAKKARA
GVVL- Isotype
- IgG
- Antibody clone number
- 3G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ITGB1BP2 expression in transfected 293T cell line by ITGB1BP2 monoclonal antibody (M02), clone 3G9.Lane 1: ITGB1BP2 transfected lysate (Predicted MW: 38.4 KDa).Lane 2: Non-transfected lysate.