Antibody data

Product number
H00026548-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026548-M02, RRID:AB_1577203
Product name
ITGB1BP2 monoclonal antibody (M02), clone 3G9
Provider product page
Abnova Corporation - H00026548-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ITGB1BP2.
Antigen sequence
KASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSS
VFLMPSRVEISLVKADPGSWAQLEHPDALAKKARA
GVVL
Isotype
IgG
Antibody clone number
3G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -