H00010180-M16

RBM6 antibody from Abnova Corporation
3G2, DEF-3, DEF3, g16, NY-LU-12

Antibody data

Product number
H00010180-M16
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010180-M16, RRID:AB_1137412
Product name
RBM6 monoclonal antibody (M16), clone 4B3
Provider product page
Abnova Corporation - H00010180-M16
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RBM6.
Antigen sequence
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCV
QQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVG
ASGRTSKRQSNETYRDAVRRVMFARYKELD
Isotype
IgG
Antibody clone number
4B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -