HPA012873

PDE5A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012873, RRID:AB_1855124
Product name
Anti-PDE5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012873
Antibody type
Polyclonal
Antigen
cGMP-specific 3',5'-cyclic phosphodiesterase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLE
AFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSY
HASAAEEETRELQSLAAAVVPSAQTLKITDFSFSD
FELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRW
IL
Storage
-20C
Provider Type Product Number
- No reagents -