HPA004469

KIF5A antibody from Sigma-Aldrich
D12S1889, MY050, NKHC, SPG10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004469
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004469, RRID:AB_1079212
Product name
Anti-KIF5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004469
Antibody type
Polyclonal
Antigen
Kinesin heavy chain isoform 5A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSL
FQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGG
PLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQ
Storage
-20C
Provider Type Product Number
- No reagents -