Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182996 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zyxin (ZYX) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZYX antibody: synthetic peptide directed towards the middle region of human ZYX
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQ
VRSPG APGPLTLKEV- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A zyxin head-tail interaction regulates zyxin-VASP complex formation.
Zyxin interacts with the SH3 domains of the cytoskeletal proteins LIM-nebulette and Lasp-1.
Moody JD, Grange J, Ascione MP, Boothe D, Bushnell E, Hansen MD
Biochemical and biophysical research communications 2009 Jan 16;378(3):625-8
Biochemical and biophysical research communications 2009 Jan 16;378(3):625-8
Zyxin interacts with the SH3 domains of the cytoskeletal proteins LIM-nebulette and Lasp-1.
Li B, Zhuang L, Trueb B
The Journal of biological chemistry 2004 May 7;279(19):20401-10
The Journal of biological chemistry 2004 May 7;279(19):20401-10
No comments: Submit comment
No validations: Submit validation data