Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051701-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051701-M02, RRID:AB_913728
- Product name
- NLK monoclonal antibody (M02), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NLK.
- Antigen sequence
DEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPK
FDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLC
INPQSAAFKSFISSTVAQPSEMPPSPLVWE- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NLK expression in transfected 293T cell line by NLK monoclonal antibody (M02), clone 2B11.Lane 1: NLK transfected lysate (Predicted MW: 57.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NLK monoclonal antibody (M02), clone 2B11. Western Blot analysis of NLK expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and NLK. HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-NLK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)