HPA004872

HGS antibody from Sigma-Aldrich
Hrs, Vps27, ZFYVE8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004872
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004872, RRID:AB_1079053
Product name
Anti-HGS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004872
Antibody type
Polyclonal
Antigen
Hepatocyte growth factor-regulated tyrosine kinase substrate recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPV
PLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPS
GGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNR
MKSNHMRGRSITNDS
Storage
-20C
Provider Type Product Number
- No reagents -