PAB29944

MFI2 antibody from Abnova Corporation
CD228, FLJ38863, MAP97, MGC4856, MTf, MTF1

Antibody data

Product number
PAB29944
Provider
Abnova Corporation
Product name
MFI2 polyclonal antibody
Provider product page
Abnova Corporation - PAB29944
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against synthetic peptide of human MFI2.
Antigen sequence
CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQER
YYGYRGAFRCLVENA
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -