HPA020130

SLC12A2 antibody from Sigma-Aldrich
BSC, BSC2, NKCC1, PPP1R141
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020130
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020130, RRID:AB_1854502
Product name
Anti-SLC12A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020130
Antibody type
Polyclonal
Antigen
Solute carrier family 12 member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLVLGFKKDWLQADMRDVDMYINLFHDAFDIQYGV
VVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVV
SVEYSKKSDLDTSKPLSE
Storage
-20C
Provider Type Product Number
- No reagents -