Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN616901 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Bone Morphogenetic Protein 7 (BMP7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-Bmp7 antibody: synthetic peptide corresponding to a region of Rat
- Description
- Affinity Purified
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQE
ALRMA SVAENSSSDQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The selection of peritoneal mesothelial cells is important for cell therapy to prevent peritoneal fibrosis.
Expression of bone morphogenic protein in sinonasal inverted papilloma with new bone formation.
Sinonasal schwannoma with new bone formation expressing bone morphogenic protein.
Kitamura S, Horimoto N, Tsuji K, Inoue A, Takiue K, Sugiyama H, Makino H
Tissue engineering. Part A 2014 Feb;20(3-4):529-39
Tissue engineering. Part A 2014 Feb;20(3-4):529-39
Expression of bone morphogenic protein in sinonasal inverted papilloma with new bone formation.
Okamoto T, Kodama S, Nomi N, Umemoto S, Suzuki M
Allergy & rhinology (Providence, R.I.) 2011 Jan;2(1):16-20
Allergy & rhinology (Providence, R.I.) 2011 Jan;2(1):16-20
Sinonasal schwannoma with new bone formation expressing bone morphogenic protein.
Kodama S, Okamoto T, Suzuki M
International journal of otolaryngology 2010;2010:154948
International journal of otolaryngology 2010;2010:154948
No comments: Submit comment
No validations: Submit validation data