HPA005558

KEAP1 antibody from Sigma-Aldrich
INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005558
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005558, RRID:AB_1079175
Product name
Anti-KEAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005558
Antibody type
Polyclonal
Antigen
Kelch-like ECH-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGI
MNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLA
SSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM
Storage
-20C
Provider Type Product Number
- No reagents -