HPA021294

AAED1 antibody from Sigma-Aldrich
C9orf21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021294
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021294, RRID:AB_1845818
Product name
Anti-C9orf21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021294
Antibody type
Polyclonal
Antigen
UPF0308 protein C9orf21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIY
VDPEREIYKRLGMKRGEEIASSGQ
Storage
-20C
Provider Type Product Number
- No reagents -