Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183082 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Homeobox A1 (HOXA1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXA1 antibody: synthetic peptide directed towards the middle region of human HOXA1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADP
PRSLS LPRIGDIFSS- Vial size
- 0.1 mg
- Storage
- Antibody is lyophilized from PBS buffer with 2% sucrose. Add 100 µl of distilled water. Final antibody concentration is 1 mg/ml. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Submitted references Association between the HOXA1 A218G polymorphism and increased head circumference in patients with autism.
Conciatori M, Stodgell CJ, Hyman SL, O'Bara M, Militerni R, Bravaccio C, Trillo S, Montecchi F, Schneider C, Melmed R, Elia M, Crawford L, Spence SJ, Muscarella L, Guarnieri V, D'Agruma L, Quattrone A, Zelante L, Rabinowitz D, Pascucci T, Puglisi-Allegra S, Reichelt KL, Rodier PM, Persico AM
Biological psychiatry 2004 Feb 15;55(4):413-9
Biological psychiatry 2004 Feb 15;55(4):413-9
No comments: Submit comment
No validations: Submit validation data