HPA023911

FAM135B antibody from Sigma-Aldrich
C8ORFK32
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023911, RRID:AB_1845791
Product name
Anti-FAM135B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023911
Antibody type
Polyclonal
Antigen
Protein FAM135B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPKDLNVGQQALSNSGISEVEGLSQHQVPELSCTS
AADAINRNSTGQQSQSGSPCIMDDTAFNRGVNAFP
EAKHKAGTVCPTVTHSVHSQV
Storage
-20C
Provider Type Product Number
- No reagents -