Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309828 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Minichromosome Maintenance Complex Component 3 (MCM3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQ
EQKRK RRKTRQPDAK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phosphorylation of MCM3 on Ser-112 regulates its incorporation into the MCM2-7 complex.
Lin DI, Aggarwal P, Diehl JA
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 10;105(23):8079-84
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 10;105(23):8079-84
No comments: Submit comment
No validations: Submit validation data