HPA011762

GALNT6 antibody from Sigma-Aldrich
GalNAc-T6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011762
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011762, RRID:AB_1849450
Product name
Anti-GALNT6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011762
Antibody type
Polyclonal
Antigen
Polypeptide N-acetylgalactosaminyltransferase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHV
SKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRN
SGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Storage
-20C
Provider Type Product Number
- No reagents -