Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406739 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cyclin T1 (CCNT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCNT1 antibody: synthetic peptide directed towards the N terminal of human CCNT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELS
YRQQA ANLLQDMGQR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Increased in vivo activation of microglia and astrocytes in the brains of mice transgenic for an infectious R5 human immunodeficiency virus type 1 provirus and for CD4-specific expression of human cyclin T1 in response to stimulation by lipopolysaccharides.
Sun J, Zheng JH, Zhao M, Lee S, Goldstein H
Journal of virology 2008 Jun;82(11):5562-72
Journal of virology 2008 Jun;82(11):5562-72
No comments: Submit comment
No validations: Submit validation data