HPA005714

FOXJ1 antibody from Sigma-Aldrich
FKHL13, HFH-4, HFH4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005714
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005714, RRID:AB_1078902
Product name
Anti-FOXJ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005714
Antibody type
Polyclonal
Antigen
Forkhead box protein J1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPP
VHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLR
EFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPR
PPSTLLPTPEEQGELEPLKG
Storage
-20C
Provider Type Product Number
- No reagents -