Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503517 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 4 (IL4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL4 antibody: synthetic peptide directed towards the middle region of human IL4
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFL
ERLKT IMREKYSKCS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Analysis of IL-10, IL-4 and TNF-alpha polymorphisms in drug-induced liver injury (DILI) and its outcome.
Pachkoria K, Lucena MI, Crespo E, Ruiz-Cabello F, Lopez-Ortega S, Fernandez MA, Romero-Gomez M, Madrazo A, Durán JA, de Dios AM, Borraz Y, Navarro JM, Andrade RJ, Spanish Group for the Study of Drug-Induced Liver Disease (Grupo de Estudio para las HepatopatÃas Asociadas a Medicamentos (GEHAM))
Journal of hepatology 2008 Jul;49(1):107-14
Journal of hepatology 2008 Jul;49(1):107-14
No comments: Submit comment
No validations: Submit validation data