Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183211 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKA
YEKPP EKKEGEEEEE- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sepantronium bromide (YM155) induces disruption of the ILF3/p54(nrb) complex, which is required for survivin expression.
Purification and identification of positive regulators binding to a novel element in the c-Jun promoter.
Host cell proteins binding to the encapsidation signal epsilon in hepatitis B virus RNA.
Yamauchi T, Nakamura N, Hiramoto M, Yuri M, Yokota H, Naitou M, Takeuchi M, Yamanaka K, Kita A, Nakahara T, Kinoyama I, Matsuhisa A, Kaneko N, Koutoku H, Sasamata M, Kobori M, Katou M, Tawara S, Kawabata S, Furuichi K
Biochemical and biophysical research communications 2012 Sep 7;425(4):711-6
Biochemical and biophysical research communications 2012 Sep 7;425(4):711-6
Purification and identification of positive regulators binding to a novel element in the c-Jun promoter.
Jiang D, Zhou Y, Moxley RA, Jarrett HW
Biochemistry 2008 Sep 2;47(35):9318-34
Biochemistry 2008 Sep 2;47(35):9318-34
Host cell proteins binding to the encapsidation signal epsilon in hepatitis B virus RNA.
Shin HJ, Kim SS, Cho YH, Lee SG, Rho HM
Archives of virology 2002 Mar;147(3):471-91
Archives of virology 2002 Mar;147(3):471-91
No comments: Submit comment
No validations: Submit validation data