HPA007151

ZFC3H1 antibody from Sigma-Aldrich
CCDC131, KIAA0546, MGC23401, PSRC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007151
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007151, RRID:AB_1846133
Product name
Anti-ZFC3H1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007151
Antibody type
Polyclonal
Antigen
Zinc finger C3H1 domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSRKQNYSSKNENCVEETFEDLLLKYKQIQLELEC
INKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVS
ITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLP
GDKNRLKKVKDGAKPLSL
Storage
-20C
Provider Type Product Number
- No reagents -