Antibody data

Product number
ABIN503564
Provider
antibodies-online
Product name
anti-Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1) antibody
Provider product page
antibodies-online - ABIN503564
Antibody type
Polyclonal
Antigen
The immunogen for anti-RAPGEF1 antibody: synthetic peptide directed towards the C terminal of human RAPGEF1
Reactivity
Human, Mouse, Rat, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQ
EKAQD RERLLLKFIK
Vial size
50 µg
Provider Type Product Number
- No reagents -