Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309699 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PIK3R3 (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PIK3R3 antibody: synthetic peptide directed towards the middle region of human PIK3R3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQ
HSKEY IERFRREGNE- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SREBP-1 regulates the expression of heme oxygenase 1 and the phosphatidylinositol-3 kinase regulatory subunit p55 gamma.
Kallin A, Johannessen LE, Cani PD, Marbehant CY, Essaghir A, Foufelle F, Ferré P, Heldin CH, Delzenne NM, Demoulin JB
Journal of lipid research 2007 Jul;48(7):1628-36
Journal of lipid research 2007 Jul;48(7):1628-36
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting