Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183776 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lysine (K)-Specific Demethylase 3B (KDM3B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-JMJD1B antibody: synthetic peptide directed towards the C terminal of human JMJD1B
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSN
THTNH EDKLQVKNII- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel nuclear protein, 5qNCA (LOC51780) is a candidate for the myeloid leukemia tumor suppressor gene on chromosome 5 band q31.
Hu Z, Gomes I, Horrigan SK, Kravarusic J, Mar B, Arbieva Z, Chyna B, Fulton N, Edassery S, Raza A, Westbrook CA
Oncogene 2001 Oct 18;20(47):6946-54
Oncogene 2001 Oct 18;20(47):6946-54
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting