HPA004747

FLNB antibody from Sigma-Aldrich
ABP-278, FH1, FLN1L, LRS1, TABP, TAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004747
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004747, RRID:AB_1848599
Product name
Anti-FLNB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004747
Antibody type
Polyclonal
Antigen
Filamin-B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNP
DLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPL
KIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIK
HTIAVVWG
Storage
-20C
Provider Type Product Number
- No reagents -