HPA015130

FCGRT antibody from Sigma-Aldrich
alpha-chain, FCRN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015130
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015130, RRID:AB_1848475
Product name
Anti-FCGRT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015130
Antibody type
Polyclonal
Antigen
IgG receptor FcRn large subunit p51 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYN
SLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKL
FLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAK
FALNGEEFMNFDLK
Storage
-20C
Provider Type Product Number
- No reagents -