Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN601356 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Follicle Stimulating Hormone Receptor (FSHR) (AA 626-659) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to aa626-659 from human Follicle Stimulating Hormone Receptor (coupled to BSA) (YAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETS).
- Description
- Immunoaffinity Chromatography
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- AA 626-659
- Isotype
- IgG
- Vial size
- 100 μg
- Concentration
- 0.2 mg/mL
- Storage
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
- Handling
- avoid freeze thaw cycles.
No comments: Submit comment
No validations: Submit validation data