HPA024585

HDHD3 antibody from Sigma-Aldrich
C9orf158, MGC12904
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024585
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024585, RRID:AB_1850565
Product name
Anti-HDHD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024585
Antibody type
Polyclonal
Antigen
Haloacid dehalogenase-like hydrolase domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARA
HGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLT
SRQWWLDVV
Storage
-20C
Provider Type Product Number
- No reagents -