HPA006884

VIL1 antibody from Sigma-Aldrich
D2S1471, VIL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006884, RRID:AB_1080566
Product name
Anti-VIL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006884
Antibody type
Polyclonal
Antigen
Villin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKV
DVFNANSNLSSGPLPIFPLEQLVNKPVEELPEGVD
PSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNL
KKE
Storage
-20C
Provider Type Product Number
- No reagents -