Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000684-B03P - Provider product page
- Provider
- Abnova Corporation
- Product name
- BST2 purified MaxPab mouse polyclonal antibody (B03P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human BST2 protein.
- Antigen sequence
PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQEL
TEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQG
QKKVEELEGEITTLNHKLQDASAEVERLRRENQVL
SVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALL
Q- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differential type 1 interferon-regulated gene expression in the brain during AIDS: interactions with viral diversity and neurovirulence.
Polyak MJ, Vivithanaporn P, Maingat FG, Walsh JG, Branton W, Cohen EA, Meeker R, Power C
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 Jul;27(7):2829-44
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 Jul;27(7):2829-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BST2 expression in transfected 293T cell line (H00000684-T05) by BST2 MaxPab polyclonal antibody.Lane 1: BST2 transfected lysate(19.91 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BST2 MaxPab polyclonal antibody. Western Blot analysis of BST2 expression in human liver.