H00005799-M01

PTPRN2 antibody from Abnova Corporation
IA-2beta, ICAAR, KIAA0387, phogrin

Antibody data

Product number
H00005799-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005799-M01, RRID:AB_1137401
Product name
PTPRN2 monoclonal antibody (M01), clone 1C5
Provider product page
Abnova Corporation - H00005799-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PTPRN2.
Antigen sequence
ELADLPKTYLRRPEASSPARPSKHSVGSERRYSRE
GGAALANALRRHLPFLEALSQAPASDVLARTHTAQ
DRPPAEGDDRFSESILTYVAHTSALTYPPGPRTQL
Isotype
IgG
Antibody clone number
1C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -