HPA024163

C7orf62 antibody from Sigma-Aldrich
MGC26647
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024163
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024163, RRID:AB_1853869
Product name
Anti-C7orf62 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024163
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf62 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLTQTHKLSLYLCQTMKVGTKGPGDNLHQVAPDLL
LPEQIIKYLCKSEEFMDPATFINMYNRPIHITLDS
EVVWPAPSRF
Storage
-20C
Provider Type Product Number
- No reagents -