Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449838 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome 3 Open Reading Frame 64 (C3orf64) (C-Term), (Isoform 1) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the C terminal of human EOGT1
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQ
HPKWPFKKKHDEL- Epitope
- C-Term,Isoform 1
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Brain; WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human brain; C3orf64 antibody - C-terminal region (AP43600PU-N) in Human Brain cells using Western Blot