HPA007121

WISP1 antibody from Sigma-Aldrich
CCN4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007121
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007121, RRID:AB_1858844
Product name
Anti-WISP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007121
Antibody type
Polyclonal
Antigen
WNT1-inducible-signaling pathway protein 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAV
GCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCE
DDAKRPRKTAPRDTGAF
Storage
-20C
Provider Type Product Number
- No reagents -