Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405980 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQ
YKATD FVADRAGTFK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Elevated CO(2) levels cause mitochondrial dysfunction and impair cell proliferation.
Silencing of mitochondrial NADP+-dependent isocitrate dehydrogenase by small interfering RNA enhances heat shock-induced apoptosis.
Vohwinkel CU, Lecuona E, Sun H, Sommer N, Vadász I, Chandel NS, Sznajder JI
The Journal of biological chemistry 2011 Oct 28;286(43):37067-76
The Journal of biological chemistry 2011 Oct 28;286(43):37067-76
Silencing of mitochondrial NADP+-dependent isocitrate dehydrogenase by small interfering RNA enhances heat shock-induced apoptosis.
Shin SW, Kil IS, Park JW
Biochemical and biophysical research communications 2008 Feb 22;366(4):1012-8
Biochemical and biophysical research communications 2008 Feb 22;366(4):1012-8
No comments: Submit comment
No validations: Submit validation data