Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- LS-C8216 - Provider product page
- Provider
- LSBio
- Product name
- Anti-IL21 Antibody (N-Terminus) LS-C8216
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21. Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset (97%); Bat, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Porcine (83%).
- Description
- Immunoaffinity purified
- Reactivity
- Human
- Host
- Goat
- Isotype
- IgG
- Vial size
- 50µg
- Storage
- Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data