LS-C8216

IL21 antibody from LifeSpan BioSciences, Inc.
IL-21, Za11
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
LS-C8216
Provider
LifeSpan BioSciences, Inc.
Product name
Anti-IL21 Antibody (N-Terminus) LS-C8216
Provider product page
LifeSpan BioSciences, Inc. - LS-C8216
Antibody type
Polyclonal
Antigen
Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21. Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset (97%); Bat, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Porcine (83%).
Description
Immunoaffinity purified
Reactivity
Human
Host
Goat
Isotype
IgG
Vial size
50µg
Storage
Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
Provider Type Product Number
- No reagents -