Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310203 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lecithin-Cholesterol Acyltransferase (LCAT) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LCAT antibody: synthetic peptide directed towards the N terminal of human LCAT
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPH
TTPKA ELSNHTRPVI- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Xanthohumol prevents atherosclerosis by reducing arterial cholesterol content via CETP and apolipoprotein E in CETP-transgenic mice.
The molecular basis of lecithin:cholesterol acyltransferase deficiency syndromes: a comprehensive study of molecular and biochemical findings in 13 unrelated Italian families.
Hirata H, Yimin, Segawa S, Ozaki M, Kobayashi N, Shigyo T, Chiba H
PloS one 2012;7(11):e49415
PloS one 2012;7(11):e49415
The molecular basis of lecithin:cholesterol acyltransferase deficiency syndromes: a comprehensive study of molecular and biochemical findings in 13 unrelated Italian families.
Calabresi L, Pisciotta L, Costantin A, Frigerio I, Eberini I, Alessandrini P, Arca M, Bon GB, Boscutti G, Busnach G, Frascà G, Gesualdo L, Gigante M, Lupattelli G, Montali A, Pizzolitto S, Rabbone I, Rolleri M, Ruotolo G, Sampietro T, Sessa A, Vaudo G, Cantafora A, Veglia F, Calandra S, Bertolini S, Franceschini G
Arteriosclerosis, thrombosis, and vascular biology 2005 Sep;25(9):1972-8
Arteriosclerosis, thrombosis, and vascular biology 2005 Sep;25(9):1972-8
No comments: Submit comment
No validations: Submit validation data