Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182496 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Arginine Methyltransferase 3 (PRMT3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFK
DKVVL DVGCGTGILS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references DAL-1/4.1B tumor suppressor interacts with protein arginine N-methyltransferase 3 (PRMT3) and inhibits its ability to methylate substrates in vitro and in vivo.
Singh V, Miranda TB, Jiang W, Frankel A, Roemer ME, Robb VA, Gutmann DH, Herschman HR, Clarke S, Newsham IF
Oncogene 2004 Oct 14;23(47):7761-71
Oncogene 2004 Oct 14;23(47):7761-71
No comments: Submit comment
No validations: Submit validation data