HPA016939

SARS antibody from Sigma-Aldrich
SERS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016939
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016939, RRID:AB_1856585
Product name
Anti-SARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016939
Antibody type
Polyclonal
Antigen
Seryl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVLSFDDLTADALANLKVSQIKKVRLLIDEAILKC
DAERIKLEAERFENLREIGNLLHPSVPISNDEDVD
NKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAV
VAGSRGYFLKGVLVFLEQALIQYAL
Storage
-20C
Provider Type Product Number
- No reagents -