HPA003162

LGALS3 antibody from Sigma-Aldrich
GALIG, LGALS2, MAC-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003162
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003162, RRID:AB_1078937
Product name
Anti-LGALS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003162
Antibody type
Polyclonal
Antigen
Galectin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGG
VVPRMLITILGTVKPNANRIALDFQRGNDVAFHFN
PRFNENNRRVIVCNTKLDNNWGREERQSVFPFESG
KPFKIQVLVEPDHFKVAVNDAHLLQYNHRVK
Storage
-20C
Provider Type Product Number
- No reagents -