Antibody data

Product number
H00004761-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004761-M01, RRID:AB_1237793
Product name
NEUROD2 monoclonal antibody (M01), clone 3E7
Provider product page
Abnova Corporation - H00004761-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NEUROD2.
Antigen sequence
RTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGS
RPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRG
PMYEE
Isotype
IgG
Antibody clone number
3E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -