HPA008840

DUSP12 antibody from Sigma-Aldrich
DUSP1, YVH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008840
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008840, RRID:AB_1847884
Product name
Anti-DUSP12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008840
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQ
ELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSI
LDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYF
IEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYG
EQCSCGRWI
Storage
-20C
Provider Type Product Number
- No reagents -