HPA008796

KIAA0907 antibody from Sigma-Aldrich
BLOM7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008796
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008796, RRID:AB_1079369
Product name
Anti-KIAA0907 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008796
Antibody type
Polyclonal
Antigen
KIAA0907 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGKLKPTQNASEKLQAPGKGLTSNKSKDDLVVAEV
EINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGR
FMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNR
IKEIITNGVVKAATGTSPTFNGATVTVYHQPAP
Storage
-20C
Provider Type Product Number
- No reagents -