Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404918 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Elongation Factor SPT5 (SUPT5H) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SUPT5H antibody: synthetic peptide directed towards the middle region of human SUPT5H
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCE
GELIN LQGKILSVDG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Differential regulation of NF-kappaB by elongation factors is determined by core promoter type.
Increased myeloid cell responses to M-CSF and RANKL cause bone loss and inflammation in SH3BP2 "cherubism" mice.
Amir-Zilberstein L, Ainbinder E, Toube L, Yamaguchi Y, Handa H, Dikstein R
Molecular and cellular biology 2007 Jul;27(14):5246-59
Molecular and cellular biology 2007 Jul;27(14):5246-59
Increased myeloid cell responses to M-CSF and RANKL cause bone loss and inflammation in SH3BP2 "cherubism" mice.
Ueki Y, Lin CY, Senoo M, Ebihara T, Agata N, Onji M, Saheki Y, Kawai T, Mukherjee PM, Reichenberger E, Olsen BR
Cell 2007 Jan 12;128(1):71-83
Cell 2007 Jan 12;128(1):71-83
No comments: Submit comment
No validations: Submit validation data