HPA006983

PRDX6 antibody from Sigma-Aldrich
1-Cys, aiPLA2, AOP2, KIAA0106, MGC46173, NSGPx, p29, PRX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006983
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006983, RRID:AB_1079595
Product name
Anti-PRDX6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006983
Antibody type
Polyclonal
Antigen
Peroxiredoxin-6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILF
SHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
IDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRN
RELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKK
LKLSILYPA
Storage
-20C
Provider Type Product Number
- No reagents -