HPA019859

antibody from Atlas Antibodies

Targeting: NUMA1

Antibody data

Submit

Validation data

Product number: HPA019859 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019859, RRID:AB_1854709
Product name: Anti-NUMA1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPEC LVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRD WEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENF LQKAPVPSTCSST
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NUMA1 protein structure - HPA019859 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and pancreas using Anti-NUMA1 antibody HPA019859 (A) shows similar protein distribution across tissues to independent antibody HPA019841 (B).
Antibody #2 product nr: HPA019841, HPA029912
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-NUMA1 antibody HPA019859.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-NUMA1 antibody HPA019859.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-NUMA1 antibody HPA019859.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-NUMA1 antibody HPA019859.
Sample type: HUMAN