Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501711 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Melanoma Antigen Family A, 9 (MAGEA9) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
QENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKV
INYLV MLNAREPICY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Generation of RAGE-1 and MAGE-9 peptide-specific cytotoxic T-lymphocyte lines for transfer in patients with renal cell carcinoma.
Oehlrich N, Devitt G, Linnebacher M, Schwitalle Y, Grosskinski S, Stevanovic S, Zöller M
International journal of cancer. Journal international du cancer 2005 Nov 1;117(2):256-64
International journal of cancer. Journal international du cancer 2005 Nov 1;117(2):256-64
No comments: Submit comment
No validations: Submit validation data