Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007182-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007182-M01, RRID:AB_606678
- Product name
- NR2C2 monoclonal antibody (M01), clone 2A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NR2C2.
- Antigen sequence
KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDG
AGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIV
TDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRH
YGAVS- Isotype
- IgG
- Antibody clone number
- 2A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody (M01), clone 2A5.Lane 1: NR2C2 transfected lysate(65.414 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NR2C2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol