H00000826-B02

CAPNS1 antibody from Abnova Corporation
30K, CANP, CANPS, CAPN4, CDPS

Antibody data

Product number
H00000826-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000826-B02, RRID:AB_1204055
Product name
CAPNS1 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00000826-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CAPNS1 protein.
Antigen sequence
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISG
AGGGGGGGGGGGGGGGGGGGGTAMRILGGVISAIS
EAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLF
AQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFG
IDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQ
AIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLY
NMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMFS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -