Antibody data

Product number
H00000653-M51
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000653-M51, RRID:AB_1137105
Product name
BMP5 monoclonal antibody (M51), clone 1G6
Provider product page
Abnova Corporation - H00000653-M51
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BMP5.
Antigen sequence
NQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHE
LYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNA
HMNATNHAIVQTLVHLMFPDHVPKPCCAPT
Isotype
IgG
Antibody clone number
1G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -